SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E3MX67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E3MX67
Domain Number 1 Region: 99-380
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 4.41e-57
Family Lambda integrase-like, catalytic core 0.0073
Further Details:      
 
Weak hits

Sequence:  A0A1E3MX67
Domain Number - Region: 48-112
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00144
Family Pseudo ankyrin repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1E3MX67
Sequence length 393
Comment (tr|A0A1E3MX67|A0A1E3MX67_9ENTR) Integrase {ECO:0000313|EMBL:ODQ02295.1} KW=Complete proteome OX=1892897 OS=Shigella sp. FC569. GN=BGK51_17220 OC=Enterobacteriaceae; Shigella.
Sequence
MPLTVRQIESAKPADKDYKLSDGQGLYLLIKKSGARYWNLKYRFAGKEKKLVIGVYPGIS
LALARQKRDEARKLLAEGKDPSYEKQASKHALRESIACTFCTLAEELFTHMACRWTAGYL
ADQRARFENHINPMLGKRPVADIRPLEILNALRVIEKNGKLEALRKTRQLCSQIFDYAIA
TGRATINPASTLNSVVLHPEKQQRRMLSEEQLGAFMYQMKVSGNFMSLVTQILVLTAVRT
GELRLATWDEIDFTNALWVIPKERMKMRRPHVVPLSHQTQMLLKEIKIITAPRNSELVIP
GVYRDNQPRGRGCINEFLQQVGWHTFTTAHGFRHTFSTILHDHDFSSAWIELQLAHVDKN
IMRGTYNHAQYLDGRREMMQWYADYIDSLSEQA
Download sequence
Identical sequences A0A085P747 A0A1E3MX67
WP_021513337.1.10748 WP_021513337.1.12458 WP_021513337.1.23970 WP_021513337.1.33948 WP_021513337.1.3398 WP_021513337.1.35003 WP_021513337.1.50214 WP_021513337.1.52881 WP_021513337.1.68952 WP_021513337.1.7617 WP_021513337.1.84668 WP_021513337.1.8848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]