SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E3NGD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E3NGD8
Domain Number 1 Region: 49-225
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 2.88e-42
Family Thiamin pyrophosphokinase, catalytic domain 0.0000258
Further Details:      
 
Domain Number 2 Region: 233-326
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.000000000000209
Family Thiamin pyrophosphokinase, substrate-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1E3NGD8
Sequence length 329
Comment (tr|A0A1E3NGD8|A0A1E3NGD8_9ASCO) Thiamine pyrophosphokinase {ECO:0000256|PIRNR:PIRNR031057} KW=Complete proteome; Reference proteome OX=763406 OS=Pichia membranifaciens NRRL Y-2026. GN=PICMEDRAFT_74654 OC=Saccharomycetes; Saccharomycetales; Pichiaceae; Pichia.
Sequence
MPTGEKLEVVEKVVENPDSISIKHTIDTNVELDTHVISPLKYFEARSRFNDESDRHTTVL
LILNQQINILPDLFAKLWNNATLKVCADGGLNRLRDYDSTSSAYIPDYVVGDLDSAKKEN
IEHYQSLGTKKILQSSQYYTDFMKALSLINTFFNFPDIISDINHLDTVDALEKLEEERSA
ESGTKVKALKIVVLGGVGGRFDQTMATINQIWNLSSRRPHLQFVILNPEHTEIIVLLKPG
FNFVAYPRFTPQEETEVFGIITEKSRPGLRNVGVLPILSDAVITTYGLKWDVENWRTGLT
TKMSSSNLQVGKEGFIIWTNKHLFVDFEL
Download sequence
Identical sequences A0A1E3NGD8
XP_019015526.1.70258 jgi|Picme1|74283|CEP18863_853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]