SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E3NUS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E3NUS5
Domain Number 1 Region: 166-246
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 1.06e-18
Family tRNA-intron endonuclease catalytic domain-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1E3NUS5
Sequence length 264
Comment (tr|A0A1E3NUS5|A0A1E3NUS5_WICAO) Uncharacterized protein {ECO:0000313|EMBL:ODQ56929.1} KW=Complete proteome; Reference proteome OX=683960 OS=Wickerhamomyces anomalus NRRL Y-366-8. GN=WICANDRAFT_15917 OC=Saccharomycetes; Saccharomycetales; Phaffomycetaceae; Wickerhamomyces.
Sequence
AGKALVFNLDVIKSLRSLGIGGVLSGTLPTAPQQNIFLGIPLQLMVEEVIWLVTKGYAYL
IPDEKLIKELVDDLDEEDIKSIQYERAIGFQSQKEQKLNQLNDKLNSLKKKVQKTPPSDA
LITQSLFVNIYDDSNSLPNNTLLKSIYAKDIKLQKRLLESLNYDRLNYLIFDYLKSKEYF
LAPGLRFGGKFIGYPGDPLRYHAHLIINAVGWDQDIGLMNIVNGGRLATGVKKVWLIGSE
NNDMDIDKDDGEVVCFSVEWAGFG
Download sequence
Identical sequences A0A1E3NUS5
XP_019036136.1.93583 jgi|Wican1|15917|gw1.8.159.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]