SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E3PIC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E3PIC0
Domain Number 1 Region: 106-211
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 2.29e-22
Family Steroid-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1E3PIC0
Sequence length 249
Comment (tr|A0A1E3PIC0|A0A1E3PIC0_9ASCO) Cytochrome b5 {ECO:0000313|EMBL:ODQ65161.1} KW=Complete proteome; Reference proteome OX=857566 OS=Nadsonia fulvescens var. elongata DSM 6958. GN=NADFUDRAFT_83225 OC=Nadsonia.
Sequence
MSSSIPSELNKEEILRNRASADASLLNTEPEILIKTVETDDVPPSKSIKQLRRENNDTES
FGVMDFLRLLGGFLGLFLMLSYYTTGTATFGYHTKFEHPRYIKSLFMPKVSLTDSQLASY
DGSNPQTPIYVAISGRVYDVTNGKDTYGPGGSYQFFAGRDAARAFSNGCFNDPSQLTWDL
RGLDEEKAASDIKGWQDFYDNDYRYWYVGEVVHEPLRGPPPSLVCKGYGSVPKHVKAEAE
TVTKNSEFE
Download sequence
Identical sequences A0A1E3PIC0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]