SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E4CHW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E4CHW6
Domain Number 1 Region: 1-80
Classification Level Classification E-value
Superfamily AF2212/PG0164-like 0.00000000000175
Family PG0164-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1E4CHW6
Sequence length 143
Comment (tr|A0A1E4CHW6|A0A1E4CHW6_9RHIZ) Uncharacterized protein {ECO:0000313|EMBL:ODT26033.1} KW=Complete proteome; Reference proteome OX=1660103 OS=Kaistia sp. SCN 65-12. GN=ABS35_11495 OC=Rhizobiaceae; Kaistia.
Sequence
MQFRAVVIPSGNATAVEIPDDVMRALGPEARPPVAISINGHSWRSRVAVMNGRRLVGISA
ANRNAAGIEEGQTIDLEISLDTAPREVEEPDDLKSALDDRPAARAAFDKLPFGLKAKHVR
DIEAAKSAEVRARRIGKLLETLA
Download sequence
Identical sequences A0A1E4CHW6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]