SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E4E1Y7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E4E1Y7
Domain Number 1 Region: 103-162
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.000002
Family Crystallins/Ca-binding development proteins 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1E4E1Y7
Sequence length 187
Comment (tr|A0A1E4E1Y7|A0A1E4E1Y7_9RHIZ) Uncharacterized protein {ECO:0000313|EMBL:ODT50452.1} KW=Complete proteome; Reference proteome OX=1660123 OS=Pelagibacterium sp. SCN 63-126. GN=ABS74_02725 OC=Hyphomicrobiaceae; Pelagibacterium.
Sequence
MLKYLAALVVLALAVTPSAALDPSGSHGWSRSQLTLRTLPHQAGDVVGTVEQDLAIKVLR
CEKLWCLVSTPVGKGWTSRDHIGFGQTSQDPLTGPNLNYASGGPGTICFYQGTNYSGASF
CAGSGEVFPDLARWGLDNSFASVKVEGNVSAAACRSRDFQSYCERIVASQPVLDGLLRKN
LTSIRVY
Download sequence
Identical sequences A0A1E4E1Y7 A0A1M3KDQ7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]