SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E4NII9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E4NII9
Domain Number 1 Region: 1-261
Classification Level Classification E-value
Superfamily ImpE-like 3.27e-89
Family ImpE-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1E4NII9
Sequence length 263
Comment (tr|A0A1E4NII9|A0A1E4NII9_9GAMM) Virulence protein SciE type {ECO:0000313|EMBL:ODU92072.1} KW=Complete proteome; Reference proteome OX=1660135 OS=Rhodanobacter sp. SCN 66-43. GN=ABT18_13390 OC=Rhodanobacteraceae; Rhodanobacter.
Sequence
MTPEAALKEGRLDEALQLLTQEVRGNPADVRRRIFLFQLLALRGEWDRAQTQLNVVGDLD
PGNTLMVTTYTAVLRGEAARADVFEGRRTPVVVGEPEAWLAMLLQALKLDAQGKHAEAVP
LRTQALEQAEASAGSIDGQAFEWIADADPRFGPCLEIVLEGGYAWVPFSRIKQLQFDPPT
DLRDKIWLPAQVTWRNGGQAVGFVPARYPGSEKAGDDDFTLARKTDWIAESEDLQTGVGQ
RMFATDAGDYPMLDARTIEFADA
Download sequence
Identical sequences A0A1E4NII9 A0A1M3QQ56

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]