SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E4RE89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E4RE89
Domain Number 1 Region: 76-212
Classification Level Classification E-value
Superfamily ISP domain 1.6e-39
Family Rieske iron-sulfur protein (ISP) 0.00000203
Further Details:      
 
Domain Number 2 Region: 31-87
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 3.05e-16
Family ISP transmembrane anchor 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1E4RE89
Sequence length 214
Comment (tr|A0A1E4RE89|A0A1E4RE89_9ASCO) Cytochrome b-c1 complex subunit Rieske, mitochondrial {ECO:0000256|RuleBase:RU004494} KW=Complete proteome; Reference proteome OX=984485 OS=Hyphopichia burtonii NRRL Y-1933. GN=HYPBUDRAFT_113312 OC=Saccharomycetes; Saccharomycetales; Debaryomycetaceae; Hyphopichia.
Sequence
MSSLAFRSLKNGFALKNSLRAFSTSTTSLSNNYQHPDFSNYLNNRGEDKSRNMTYFMVGS
MGLLGAAGAKSTVEAFLSSLSASADVLAMAKVEVKLGAIPEGKNVIVKWQGKPVFIRHRT
QDEIDEANKIDITSLRDPQNDDDRVKKPEWLIMLGICTHLGCVPIGEAGDFGGWFCPCHG
SHYDISGRIRRGPAPLNLEIPTYDFTDDETLLVG
Download sequence
Identical sequences A0A1E4RE89
jgi|Hypbu1|143311|estExt_Genewise1Plus.C_7_t20110 XP_020074651.1.17418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]