SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E4RGE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E4RGE9
Domain Number 1 Region: 140-281
Classification Level Classification E-value
Superfamily Translational machinery components 6.02e-45
Family ERF1/Dom34 middle domain-like 0.0000236
Further Details:      
 
Domain Number 2 Region: 272-380
Classification Level Classification E-value
Superfamily L30e-like 4.66e-35
Family ERF1/Dom34 C-terminal domain-like 0.000068
Further Details:      
 
Domain Number 3 Region: 1-133
Classification Level Classification E-value
Superfamily Dom34/Pelota N-terminal domain-like 1.09e-34
Family Dom34/Pelota N-terminal domain-like 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1E4RGE9
Sequence length 395
Comment (tr|A0A1E4RGE9|A0A1E4RGE9_9ASCO) Protein DOM34 homolog {ECO:0000256|RuleBase:RU362019} KW=Complete proteome; Reference proteome OX=984485 OS=Hyphopichia burtonii NRRL Y-1933. GN=HYPBUDRAFT_153234 OC=Saccharomycetes; Saccharomycetales; Debaryomycetaceae; Hyphopichia.
Sequence
MKLLDKTIELEKDKSGSISIVPQDKEDLWQLYNLIQKGDEVELSTYRNVKKTTGSGATDG
KDKGKTERKLLRLKLAVSDIEYAPSDESMRIKGKTTEQNQYVPNQSFHTAEVQLQKSLRI
TKPEWDDISYGIILAASSVETRAEVGAIVMEEGVAHLCLLTDNMTVLRNKIEKSIPRKSR
GEGGGGNHDKAITKFLDMVQSTMLRNFDLTKLKVVILASPGFTASLLQKNIMEHAVKDDN
KLIMKNKSKFLVVHSSTGYLQGLEEVLKDPSVQKRLNDTKYAREVNIFDEFQKSLNDDDD
KAWYGPSEVAKAVEIGAVKYLLLTDTLFRSDDISVRKHYIKLSDEVKSQGGEVLIFSSLH
ESGEQLDQLTGVASILKYPVADLDEEEEEEEEEEE
Download sequence
Identical sequences A0A1E4RGE9
XP_020075400.1.17418 jgi|Hypbu1|153234|fgenesh1_kg.5_#_32_#_Locus3044v1rpkm37.80

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]