SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E4S6E8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E4S6E8
Domain Number 1 Region: 248-338
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000275
Family Pseudo ankyrin repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1E4S6E8
Sequence length 351
Comment (tr|A0A1E4S6E8|A0A1E4S6E8_CYBJA) Uncharacterized protein {ECO:0000313|EMBL:ODV75050.1} KW=Complete proteome; Reference proteome OX=983966 OS=Cyberlindnera jadinii NRRL Y-1542. GN=CYBJADRAFT_68344 OC=Saccharomycetes; Saccharomycetales; Phaffomycetaceae; Cyberlindnera.
Sequence
MGFVRPAKSKKRLRTPTSRPSKRQKKDGAASTSSSECPSATSSRPTTPAQGVTVEVPTGS
ILERLPVEILQEVFVFSGVSSLPLTCKSINRSLRPSHSLRLAMLKTFVYDLNCKVRTDAY
KTAFALDRDCLQYKFVNSKVLKEINFDIVLPMRSIVAESKNRLMLHYDSLNKRLLETLYL
NNADADEINRELARMTEERSSMDDIQTEDLPSAEEFEDYPERFYTHFSQNHIEMAETLYN
TGMRFKVSGKVMSMAISEHCDVKTLSRILKCTETGTITSVEPVISAFANDDLATVEWLLE
MKADDADLINNDDLWIWIGQKKRTKFLKFLTDKGANPSHGIIGAISNNLHG
Download sequence
Identical sequences A0A1E4S6E8
XP_020072089.1.24254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]