SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E4SJM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E4SJM8
Domain Number 1 Region: 197-317
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.49e-30
Family cAMP-binding domain 0.00013
Further Details:      
 
Domain Number 2 Region: 324-438
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.4e-30
Family cAMP-binding domain 0.00045
Further Details:      
 
Weak hits

Sequence:  A0A1E4SJM8
Domain Number - Region: 10-40
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000118
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1E4SJM8
Sequence length 469
Comment (tr|A0A1E4SJM8|A0A1E4SJM8_9ASCO) cAMP-dependent protein kinase regulatory subunit {ECO:0000256|PIRNR:PIRNR000548} KW=Complete proteome; Reference proteome OX=984487 OS=Suhomyces tanzawaensis NRRL Y-17324. GN=CANTADRAFT_20995 OC=Saccharomycetes; Saccharomycetales; Debaryomycetaceae; Suhomyces.
Sequence
MAQQQFITDELNQLQKDIISKNPSDILQFCANYFNTKLQSQRSQLWSQQHKAKAAGINLF
PDVENVNINSFGSGVVLDRQPSFKSPFGDNDPHSNHNDDDPHGPGAAGAPESSTSNKAGL
FKNNFDVSHQAPQKHDHDVDPSDSTTTSGSSFPGKSTGPFAKGLSKIPIAFNANRRTSVS
AEALNPDKFKSDSWKPPTNNLTSSQRADLSKTLASNFLFQQLDGTSKKTVIEALSPKTFS
KDTEIITQGDEGDYFYIIEKGTVDFYVNGSKVNSSNEGSSFGELALMYNSPRAATAVAAT
DVTCWALDRLTFRRILLEGTFNRRLMYEDFLKDVEVLKSLSSHERSKLADALSTEIYEKG
DKIVTEGEQGENFYFIESGSCQVYNNQSGVIKQLTKGDYFGEIALLNDKPRQATVEALDH
VIVATLGKAGFQRLLGPAVEVLKSNDPTAPRTHENASASQHPTSVAASK
Download sequence
Identical sequences A0A1E4SJM8
jgi|Canta1|20995|fgenesh1_pg.3_#_159 XP_020064820.1.41638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]