SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E4X811 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E4X811
Domain Number 1 Region: 4-162
Classification Level Classification E-value
Superfamily Heme iron utilization protein-like 3.27e-55
Family ChuX-like 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1E4X811
Sequence length 170
Comment (tr|A0A1E4X811|A0A1E4X811_9GAMM) HuvX protein {ECO:0000313|EMBL:OEC67431.1} KW=Complete proteome OX=1535538 OS=Aeromonas sp. ANP5. GN=A9G49_02255 OC=Aeromonadaceae; Aeromonas.
Sequence
MSIAQRIHALLEQDPGAHPSTLAAQLAISEWEVVRHLPAELVTLLPADRAQGLLEDLADW
GPVTTIVESEGSIFEVKAPFPKGKDARGYYNLMGRDGELHGHLKLDNVAGIALVSKLFMG
KEGHSFQFFGHSGRCMFKVYLGRDEKRQLLADQVTRFMALRHNSQEEVKA
Download sequence
Identical sequences A0A1E4X811 A0A1Q8FAA4
WP_042080089.1.12376 WP_042080089.1.19238 WP_042080089.1.26577 WP_042080089.1.2836 WP_042080089.1.31752 WP_042080089.1.32015 WP_042080089.1.33469 WP_042080089.1.40643 WP_042080089.1.57093 WP_042080089.1.59211 WP_042080089.1.62883 WP_042080089.1.68908 WP_042080089.1.70826 WP_042080089.1.74871 WP_042080089.1.86252 WP_042080089.1.91975 WP_042080089.1.93943 WP_042080089.1.96069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]