SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E5AEG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E5AEG6
Domain Number 1 Region: 14-73
Classification Level Classification E-value
Superfamily WGR domain-like 0.000000000719
Family WGR domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1E5AEG6
Sequence length 75
Comment (tr|A0A1E5AEG6|A0A1E5AEG6_9RHOB) Uncharacterized protein {ECO:0000313|EMBL:OED48480.1} KW=Complete proteome OX=1868286 OS=Rhodobacteraceae bacterium (ex Bugula neritina AB1). GN=AB838_11220 OC=Rhodobacteraceae.
Sequence
MATCLLYRQVPSRPARFYRIELAMNLFSEVSVLREWGVAGGNGQSVINNYGNLREASLAA
DKHRNRMIKRGYGRA
Download sequence
Identical sequences A0A1E5AEG6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]