SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E5DI73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1E5DI73
Domain Number - Region: 28-64
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 0.00785
Family RecG, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1E5DI73
Sequence length 98
Comment (tr|A0A1E5DI73|A0A1E5DI73_9VIBR) Uncharacterized protein {ECO:0000313|EMBL:OEE84117.1} KW=Complete proteome OX=1136164 OS=Vibrio cyclitrophicus FF160. GN=OAI_21475 OC=Vibrionaceae; Vibrio.
Sequence
MKQILNNAVVADGVDDIFTMVGLDKPNIGLLSEEFLEDVKNMKEKNLAVELLEKLLRDEV
KARMKNDVVQEKKYFERIMSTLQKYHNRSIETAQVIES
Download sequence
Identical sequences A0A1E5DI73

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]