SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E5NHR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E5NHR3
Domain Number 1 Region: 212-567
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.18e-70
Family Ankyrin repeat 0.00014
Further Details:      
 
Weak hits

Sequence:  A0A1E5NHR3
Domain Number - Region: 82-191
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000209
Family Pseudo ankyrin repeat 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1E5NHR3
Sequence length 572
Comment (tr|A0A1E5NHR3|A0A1E5NHR3_9SPIR) Uncharacterized protein {ECO:0000313|EMBL:OEJ15607.1} KW=Complete proteome OX=1287055 OS=Brachyspira hampsonii. GN=A9495_09390 OC=Bacteria; Spirochaetes; Brachyspirales; Brachyspiraceae; Brachyspira.
Sequence
MEKLEKIYRSGNLKDFQLFFKSHIKNYCSDNGVEIVRNLIHCDNEDNKFKLFKFFIDYLS
DKKFIKISDDFLFKISSILIDNNYMDLFKYAVSKKFYISSDNCVEIIRKLIHSDNEDNKF
ELFKYFIDRLKNRSYLIIKIFKEVYKKQDADFIEYLEKKFHIKEILLIEACGKNNLEWVK
YLVRNGANINGKINNHNIFEYFDHCTILDLDIKIIEYLLNYANEENYKSALFICCENNYF
ELVKYILTKGIDINIKNRYEKTPLIIACLNEHLNLAEYLIKNGADINIKDKYNENLLFKD
RINNNFELSKLLIDLGIDINTRNNKKETPLYTAFRNNNFELVKYLINNNAYTNIYDQVNL
FRIACENDNLKLIKYLLEIGFNIDKKLLKGTLLFADKNCDLETVEYLTKIGFNIKIKDLK
ELLFMSIINNNFNRIKCLADNGINMNCFHYRPLMYACINGDLNLVKLLLDNGADINAVNH
KKNNSLHFALNQAKYDVAEFLLDNGADINNRDSHGQTSLIKYSKAGNYNAVKLLIKYKAD
INIKDNDGHDALYYAELYKKQMTIELLVKYKV
Download sequence
Identical sequences A0A1E5NHR3
WP_008724166.1.101799 WP_008724166.1.32107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]