SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E5WLI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E5WLI1
Domain Number 1 Region: 226-308
Classification Level Classification E-value
Superfamily TAZ domain 0.0000000000109
Family TAZ domain 0.001
Further Details:      
 
Domain Number 2 Region: 13-83,122-144
Classification Level Classification E-value
Superfamily POZ domain 0.000000424
Family BTB/POZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1E5WLI1
Sequence length 358
Comment (tr|A0A1E5WLI1|A0A1E5WLI1_9POAL) BTB/POZ and TAZ domain-containing protein 2 {ECO:0000313|EMBL:OEL38266.1} KW=Complete proteome; Reference proteome OX=888268 OS=Dichanthelium oligosanthes. GN=BAE44_0000713 OC=Dichanthelium.
Sequence
MAALYADLDAFRESAADVRIVTSDGQTIAAHSYILASASPVLERMIDMSRRGCGAGGCTI
RVLGVPSDAVLAFLHLLSASRVEPGMQEAALAAHAPQLLALAHAYRVGWLKRAAEAAVSA
RLTPARAVDMLKLAGLCDAPRLRAACARLAAKDLAAIEASDGWRFARRHDPALELELLQL
LEEADQRRARWVRERASREAYRQLAEAMDALDRIFAADDAPCSTTCGSGGKPCARDDDDN
DGTCQGLRLLMRHFAGCARKAAPGGCPRCRRLLQLFRLHASVCDRPEQDQDDQPCRVPLC
SHFTAKMQAEKADKTWQLLVKKVTRARAMARLGHWQVPEVVAMSWARYNSSSKWARLR
Download sequence
Identical sequences A0A1E5WLI1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]