SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E7FER2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1E7FER2
Domain Number - Region: 44-81
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000233
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1E7FER2
Sequence length 93
Comment (tr|A0A1E7FER2|A0A1E7FER2_9STRA) Dpy-30-domain-containing protein {ECO:0000313|EMBL:OEU16672.1} KW=Complete proteome; Reference proteome OX=635003 OS=Fragilariopsis cylindrus CCMP1102. GN=FRACYDRAFT_185174 OC=Bacillariophycidae; Bacillariales; Bacillariaceae; Fragilariopsis.
Sequence
MAAAPPLQLPVPAVKTESAPAAVAAPPAPAAAVAPTPEVQSMPIRAYLDQTVVPILLDGM
SELVKERPANPIEYLAQYLMRHDPSRAGIVAPK
Download sequence
Identical sequences A0A1E7FER2
jgi|Fracy1|185174|e_gw1.6.1496.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]