SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E8AEI0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1E8AEI0
Domain Number - Region: 158-190
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 0.0902
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1E8AEI0
Sequence length 293
Comment (tr|A0A1E8AEI0|A0A1E8AEI0_BACTU) Uncharacterized protein {ECO:0000313|EMBL:OFD05768.1} KW=Complete proteome OX=1428 OS=Bacillus thuringiensis. GN=BTGOE7_39660 OC=Bacillus cereus group.
Sequence
MIEICFEEKNDAMYVYKQLLKRAEVLYKETSVYLQEQKVVIHIPVCESHYIEKILLPVMV
YFIVNVKQNEWIYTILKEKFFYEEQEECHQILHIAQEVLKGRRNGVARELTRYTFESYIK
SSLNNWLCDPLSFSFSSYVRFRLRTYREMVAKLTEVAIDEYKMEQEYQMFIETLRQQVSN
RKSRLSCMHLIFDESFIFYDDKGRRLKQEKLVQYIDEDLLKQKDVYIDTKVIAPLLSISP
KKIYLYTKEQDHNMIITLRNVFQERIQIHGLHEFERNVKNLKNKGNALDFLSF
Download sequence
Identical sequences A0A1E8AEI0 A0A242X254 A0A2B5E655 K0FTH0
WP_000569634.1.11380 WP_000569634.1.13113 WP_000569634.1.3196 WP_000569634.1.42747 WP_000569634.1.5841 WP_000569634.1.60012 WP_000569634.1.89698 gi|407707092|ref|YP_006830677.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]