SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E9LZY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1E9LZY4
Domain Number - Region: 4-32
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 0.0302
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1E9LZY4
Sequence length 54
Comment (tr|A0A1E9LZY4|A0A1E9LZY4_9MICC) Ribosome recycling factor {ECO:0000313|EMBL:OFM21265.1} KW=Complete proteome OX=1715189 OS=Rothia sp. HMSC069D01. GN=HMPREF2710_03440 OC=Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Rothia.
Sequence
MGFDIKGTVEQGLDKAQEVINEKAGKEVVTDEHVAKVEEVVTENVSKLTEKFGK
Download sequence
Identical sequences A0A0K2RYW7 A0A0T9PY72 A0A1E8RTR9 A0A1E8S7B1 A0A1E8TU80 A0A1E9GC75 A0A1E9IFF3 A0A1E9LZY4 A0A1E9ZED0 A0A1F0DGY9 A0A1F0PST0 A0A1F0QZI5 A0A1F0XXH6 A0A1F0YZQ0 A0A1F1D8I5 A0A1S1CAK9 A0A1S1D429 A0A1S1D6T9 D2NQC7 G5EP28
WP_005504128.1.101460 WP_005504128.1.102058 WP_005504128.1.10556 WP_005504128.1.10638 WP_005504128.1.14602 WP_005504128.1.15594 WP_005504128.1.23324 WP_005504128.1.281 WP_005504128.1.29843 WP_005504128.1.31261 WP_005504128.1.3918 WP_005504128.1.39259 WP_005504128.1.39477 WP_005504128.1.40188 WP_005504128.1.42107 WP_005504128.1.43391 WP_005504128.1.46547 WP_005504128.1.48182 WP_005504128.1.49210 WP_005504128.1.56984 WP_005504128.1.59551 WP_005504128.1.59805 WP_005504128.1.75753 WP_005504128.1.7946 WP_005504128.1.87139 WP_005504128.1.87393 WP_005504128.1.87916 WP_005504128.1.89755 WP_005504128.1.94437 WP_005504128.1.99508 680646.RMDY18_00210 gi|283457109|ref|YP_003361673.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]