SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F0XVJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1F0XVJ8
Domain Number - Region: 88-112
Classification Level Classification E-value
Superfamily GLA-domain 0.0314
Family GLA-domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1F0XVJ8
Sequence length 128
Comment (tr|A0A1F0XVJ8|A0A1F0XVJ8_9MICC) Uncharacterized protein {ECO:0000313|EMBL:OFQ60614.1} KW=Complete proteome OX=1739432 OS=Rothia sp. HMSC072B04. GN=HMPREF2928_02040 OC=Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Rothia.
Sequence
MTTPNLSTTDLRTSEEARDLQTLLFIDLHTSLGAEPEGIPEAERLNESDHHDIHLDLHAE
ESKHSPFEGIGITLTEPSLVARFRGVRRDLEREIAGDMCTVEQARRYLEHLEIVLLLEQD
GDTPSRSF
Download sequence
Identical sequences A0A1E8SA92 A0A1E8TSK7 A0A1F0VUN1 A0A1F0XVJ8 A0A1S1CCI6 G5EQ28
WP_005504812.1.101460 WP_005504812.1.23324 WP_005504812.1.39477 WP_005504812.1.59805 WP_005504812.1.75753 WP_005504812.1.97539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]