SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F1LDS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F1LDS8
Domain Number 1 Region: 71-141
Classification Level Classification E-value
Superfamily ACT-like 0.000000074
Family AF1403 N-terminal domain-like 0.061
Further Details:      
 
Weak hits

Sequence:  A0A1F1LDS8
Domain Number - Region: 22-59
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 0.0719
Family DNA polymerase beta-like, second domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1F1LDS8
Sequence length 145
Comment (tr|A0A1F1LDS8|A0A1F1LDS8_9CLOT) UPF0735 ACT domain-containing protein HMPREF3070_01530 {ECO:0000256|HAMAP-Rule:MF_00707} KW=Complete proteome OX=1581148 OS=Clostridium sp. HMSC19A10. GN=HMPREF3070_01530 OC=Clostridium.
Sequence
MSGNYLVIDKRVLPDVYEKVLFAKKLLKDGKIKEITEAVKIAGISRSVYYKYKDHVFDFS
ETSEGRKVTYNIILKNEKGVLSIISNYIAEQGGDILTINQGIPLNGYANLSITIDLSCVD
GDIKTLTDGLSNLKNIEKVEFIGME
Download sequence
Identical sequences A0A0A6Q0K9 A0A1F1LDS8 C4IK38 W1U7N4
WP_003414677.1.14886 WP_003414677.1.36140 WP_003414677.1.57752 WP_003414677.1.64220 WP_003414677.1.68983 WP_003414677.1.80740 WP_003414677.1.87686 WP_003414677.1.91059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]