SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F1U7B5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1F1U7B5
Domain Number - Region: 24-59
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0314
Family Moesin tail domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1F1U7B5
Sequence length 67
Comment (tr|A0A1F1U7B5|A0A1F1U7B5_9MICO) Uncharacterized protein {ECO:0000313|EMBL:OFT21991.1} OX=1581144 OS=Dermabacter sp. HMSC08H10. GN=HMPREF3176_00410 OC=Dermabacter.
Sequence
MGRGRQKAKQAKIARDLKYYSPPTDLNALQRELSGKKNESASWDEDDRYEDKWASEYDDW
ADEDEES
Download sequence
Identical sequences A0A069T4K5 A0A1F1U7B5 A0A1F1WB25 A0A2I1LM68 S3XZA3
WP_016663928.1.13199 WP_016663928.1.33621 WP_016663928.1.74460 WP_016663928.1.79907 WP_016663928.1.84330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]