SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F2GHV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F2GHV7
Domain Number 1 Region: 1-209
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.7e-38
Family Nucleotide and nucleoside kinases 0.00000447
Further Details:      
 
Domain Number 2 Region: 127-159
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0000327
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1F2GHV7
Sequence length 212
Comment (tr|A0A1F2GHV7|A0A1F2GHV7_9STRE) Adenylate monophosphate kinase {ECO:0000256|HAMAP-Rule:MF_00235} KW=Complete proteome OX=1581076 OS=Streptococcus sp. HMSC10A01. GN=HMPREF3108_03330 OC=Streptococcus.
Sequence
MNLLIMGLPGAGKGTQAAKIVEKFKVAHISTGDMFRAAIANQTEMGVLAKSYIDKGELVP
DEVTNGIVKERLSQEDIKETGFLLDGYPRTIDQAHALDAILKDLGIDLDGVINIEVDPSC
LLERLSGRIIHRQTGETFHKVFNPPANYNEEDYYQREDDKPETVKRRLDVNIAQGEPILA
HYRELKLVHDIQGNQDINDVFSDIEKVLEKLK
Download sequence
Identical sequences A0A134DBT5 A0A1F2GHV7
WP_060554199.1.1781 WP_060554199.1.26655 WP_060554199.1.4669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]