SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F3CB29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F3CB29
Domain Number 1 Region: 17-281
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.67e-74
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000115
Further Details:      
 
Domain Number 2 Region: 283-406
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.01e-32
Family Anticodon-binding domain of Class II aaRS 0.0000393
Further Details:      
 
Domain Number 3 Region: 409-480
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 1.35e-17
Family C-terminal domain of ProRS 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1F3CB29
Sequence length 480
Comment (tr|A0A1F3CB29|A0A1F3CB29_9BACT) Prolyl-tRNA synthetase {ECO:0000256|HAMAP-Rule:MF_01571} KW=Complete proteome; Reference proteome OX=1797288 OS=Armatimonadetes bacterium RBG_16_67_12. GN=A2Z07_12335 OC=Bacteria; Armatimonadetes.
Sequence
MSTEPQVFVKEIPSKAEQFSDWYTAVCLKAELADYSPVRGCMVIRPYGYALWEGIQRWLD
DRFKATGHVNAYFPLFVPESFLKKEAEHVEGFAPQVAWVTHGGDEELAERLAVRPTSEAI
ILPMYAKWIQSYRDLPVLLLQWNSVVRWEKATRLFLRTTEFLWHEGHTAHATLEEADQEC
LTILEIYRQLLEDILAIPVLVGRKPASEKFAGADWTYTLEALMPDRQAIQAGTSHFLGQN
FARAFNVKFLDRDNSEKYIWSTSWAVTTRLIGSLVMAHGDDRGLALPPRIAPVQVVIVPI
PGKDGEKVLAAARALAERLKKVARVRLDDRDEYTPGWKFNDWEMRGVPIRIEIGPRDVAA
DQAVIVKRTGGGKETVSLDGVEGRIAAALDEVQAAFFNQAKAFRDAHTVAAETIEALEEA
IRERRGFVRTNWCGEQSCEDAIRDRTGASPRVIPLHDEPKGSCITCGKPSTATVYYARAY
Download sequence
Identical sequences A0A1F3CB29

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]