SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F4AQW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F4AQW3
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 4.29e-34
Family NIPSNAP 0.0000578
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1F4AQW3
Sequence length 114
Comment (tr|A0A1F4AQW3|A0A1F4AQW3_9PROT) NIPSNAP domain containing protein {ECO:0000313|EMBL:OGA14547.1} KW=Complete proteome OX=1797486 OS=Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_63_19. GN=A3H32_07995 OC=Bacteria; Proteobacteria; Betaproteobacteria.
Sequence
MIVEERIYRMKPGKAPEYIKGYAQEGLAIQRPILGNLVGYYATEIGELNLVVHMWAYEDM
ADRAARRARLSADPRWQAYLPKVSSFVEHQQNRILNPAPFFEPMLRAMLAANPA
Download sequence
Identical sequences A0A1F4AQW3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]