SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F4J1C0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F4J1C0
Domain Number 1 Region: 1-137
Classification Level Classification E-value
Superfamily RPA2825-like 1.19e-38
Family RPA2825-like 0.0000755
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1F4J1C0
Sequence length 138
Comment (tr|A0A1F4J1C0|A0A1F4J1C0_9BURK) Oxidoreductase {ECO:0000313|EMBL:OGB16199.1} KW=Complete proteome; Reference proteome OX=1797564 OS=Burkholderiales bacterium RIFCSPLOWO2_02_FULL_67_64. GN=A3I64_04560 OC=Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales.
Sequence
MGFFSNILEKLGMKEAAAAPVITPPPAAAAPTPAAAPAPVAAAPAEPVVNPIAMVDVVAL
LTEKAAHHPEKLNWKTSIVDLLKLLGLDSSLAARKELARELYCPDDKMADSAQMNMWLHK
NVLGHIAANGGNIPKELL
Download sequence
Identical sequences A0A1F4J1C0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]