SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F4K0X6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F4K0X6
Domain Number 1 Region: 18-201
Classification Level Classification E-value
Superfamily CbiG N-terminal domain-like 1.1e-52
Family CbiG N-terminal domain-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1F4K0X6
Sequence length 259
Comment (tr|A0A1F4K0X6|A0A1F4K0X6_9BURK) Cobalamin biosynthesis protein CbiG {ECO:0000313|EMBL:OGB28353.1} KW=Complete proteome; Reference proteome OX=1797566 OS=Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40. GN=A3F78_21240 OC=Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales.
Sequence
MSSTTPSDTAPAQEGAVRVVLIAITKHGAQQTAELARQLPAASICVADKFAPLMAGLANP
VRAYSGAFRDEIAQLFADFDQLVFFVSLGAVVRLIAPHMKNKDEDPGVLVVDDAGQFVIP
VLSGHVGGANAMAEQIAALLGGTAVLTTASDVGKTIAVDILGRELGWKVECPKINITRVS
AAVVNEEPVAVVQEAGSPHWWTRPTPLPASIHRFTRLEDVDLERFKAVLWITHAEVTPER
WAQLHERLVVYRPPQGQGV
Download sequence
Identical sequences A0A1F4K0X6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]