SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F4PK48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F4PK48
Domain Number 1 Region: 21-35,75-165
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000196
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1F4PK48
Sequence length 212
Comment (tr|A0A1F4PK48|A0A1F4PK48_9BACT) Uncharacterized protein {ECO:0000313|EMBL:OGB83936.1} KW=Complete proteome; Reference proteome OX=1802375 OS=candidate division TM6 bacterium RIFCSPHIGHO2_12_FULL_32_22. GN=A3F66_02225 OC=Bacteria; Candidatus Dependentiae.
Sequence
MKRILLAITCLTFSIQPINFITKTCFKVCNDEKKEEQLNNAIKHCVEHRLRVKDLEELIE
LAPHACIQTDSLNQLLANACRNNNFDLVKFAIEKGANANCRIDGFSIPLLEASAALCKQR
EPKTEILQLLIQKNASAENFDEKNHYDSRIKLILVENLQLTNTNTYKLFIEFVNKNKKVF
EKLNLNTTKNLSAPEKIVKGVGQYVLKRFGFN
Download sequence
Identical sequences A0A1F4PK48

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]