SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F4XGH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F4XGH3
Domain Number 1 Region: 6-98
Classification Level Classification E-value
Superfamily AF2212/PG0164-like 0.000000000000288
Family PG0164-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1F4XGH3
Sequence length 100
Comment (tr|A0A1F4XGH3|A0A1F4XGH3_9BACT) Uncharacterized protein {ECO:0000313|EMBL:OGC80718.1} KW=Complete proteome; Reference proteome OX=1797243 OS=Candidatus Adlerbacteria bacterium RIFCSPLOWO2_01_FULL_51_16. GN=A2943_02410 OC=Bacteria; Candidatus Adlerbacteria.
Sequence
MQKKVYKTRAKVWLYPGSTAAWHFIFVDKKYAKELKEKFGKVKRGFGSIPVVATIGKTSW
QTSIFPDKRAGTYLLPLKLKVRQAEHFASGDTITFFVQVR
Download sequence
Identical sequences A0A1F4XGH3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]