SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F5CUH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F5CUH5
Domain Number 1 Region: 3-137
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 2.88e-45
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.00023
Further Details:      
 
Domain Number 2 Region: 140-267
Classification Level Classification E-value
Superfamily Translational machinery components 6.98e-35
Family ERF1/Dom34 middle domain-like 0.00057
Further Details:      
 
Domain Number 3 Region: 272-416
Classification Level Classification E-value
Superfamily L30e-like 4.06e-30
Family ERF1/Dom34 C-terminal domain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1F5CUH5
Sequence length 419
Comment (tr|A0A1F5CUH5|A0A1F5CUH5_9ARCH) Translation termination factor aRF1 {ECO:0000256|HAMAP-Rule:MF_00424} KW=Complete proteome; Reference proteome OX=1797381 OS=Candidatus Bathyarchaeota archaeon RBG_16_48_13. GN=A3K70_03520 OC=Archaea; Candidatus Bathyarchaeota.
Sequence
MPDKSSLSQFRLKRALGVLASKEGRGTELISLYVTPGKQIYDVISQLRQEYTTASNIKSA
TTRKHVQDAITRTMQRLKLFKTPPDTGLVIFCGALPQNGPGSERIELYVIVPPDPIRIYT
YRCDSKFLLDPIREMVKVKEVYGILVMDASGAIFALLKGGNLEIVREITSGVSGKHRAGG
QSARRFERLREAELNSFFNRVGIYASEIFLQVPNLKGILVGGPGPTKYDFVDGDHMQYTL
RGKVLSIVDTAYVEEQGVEEVVEKSPGTLLAVRYREEKQAVQKFLYELGHGTGLATYGEE
EVRRSLKGGIAQMLLLSAELKKTRLYVKCQSCDHREERTVSTADLHDAEDEIKNTPCPKC
NNKNMVIDETKDLVDDFADMAEQAGTDIEIITKETAEGEMLRDSFGGIAAILRFKQSQT
Download sequence
Identical sequences A0A1F5CUH5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]