SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F5G413 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F5G413
Domain Number 1 Region: 165-277
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 0.000000732
Family PA0094-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1F5G413
Sequence length 288
Comment (tr|A0A1F5G413|A0A1F5G413_9BACT) Uncharacterized protein {ECO:0000313|EMBL:OGD86588.1} KW=Complete proteome; Reference proteome OX=1797705 OS=Candidatus Curtissbacteria bacterium RBG_13_35_7. GN=A2164_03475 OC=Bacteria; Candidatus Curtissbacteria.
Sequence
MPDYIEPNQIFNQPQGQPAQVPLAGTSPEQTPQQPQSQVPNIPFKPPVTPTNGQENGASK
FSLKMLLVIALAFLLLVVIIAAVYFFVQNSKNNQASDQLLNQQNQLDAALNQNQSQIAPS
PTPTPFPEHFYSNSAAGISFEAPNGWKKVESPSLLILYQNPIAETDASGNLFYPNLNLNV
DNNPGTEILEEYVEKSNNSKIAYLENYSLIGSAKEQLGGQPAYIDDYTVTLDTIAVRQRQ
VISLYNGKAYIFTFSSLPESWQSNLPIYDTVRSTFIFSATVSGVRTGI
Download sequence
Identical sequences A0A1F5G413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]