SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F5LH87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F5LH87
Domain Number 1 Region: 83-149
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 3.93e-20
Family Steroid-binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1F5LH87
Sequence length 243
Comment (tr|A0A1F5LH87|A0A1F5LH87_9EURO) Uncharacterized protein {ECO:0000313|EMBL:OGE52583.1} KW=Complete proteome; Reference proteome OX=1835702 OS=Penicillium arizonense. GN=PENARI_c010G10749 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MSELRQRPTAARSEKTEIPQRRRSSDNDGDHGISLLDMIRVIVTLIVASCGLSYYMTSTE
SMLWGYRPWFTRWPVVKQWVNGPVNLTPAQLSLYNGTDTTLPLYLAVNGTIYDVSENRMI
YGPGGSYNFFAGRDATRAFVTGCFKDDLTADIRGVETMFVPVEDVVDEALTSAQKKIRRE
RELRAAKAKVEATVKKWQGFFANHKKYFEVGRVVDGVADGKEWPLCESAEKQRPKRSAMK
EKS
Download sequence
Identical sequences A0A1F5LH87

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]