SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F5LIX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F5LIX6
Domain Number 1 Region: 46-156
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.15e-27
Family Steroid-binding domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1F5LIX6
Sequence length 166
Comment (tr|A0A1F5LIX6|A0A1F5LIX6_9EURO) Uncharacterized protein {ECO:0000313|EMBL:OGE53046.1} KW=Complete proteome; Reference proteome OX=1835702 OS=Penicillium arizonense. GN=PENARI_c008G08826 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MADNSVPQAEVMSIASPINLILLSLFVVLVYWHFRPKAPVALPRGPPPVVFKTYTPKTLI
KYNGLNDQPVYLAVRGRVFDVSPGRNFYGPGGPYENFAGRDASRGLAHQSFDEEMLTKDL
SAPLDKLEDLDEDQLENLQSWEERFLEKYLVVGKLVAEGDPEAPSS
Download sequence
Identical sequences A0A1F5LIX6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]