SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F6Z3V1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F6Z3V1
Domain Number 1 Region: 4-150
Classification Level Classification E-value
Superfamily MTH1598-like 8.37e-29
Family MTH1598-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1F6Z3V1
Sequence length 150
Comment (tr|A0A1F6Z3V1|A0A1F6Z3V1_9ARCH) Uncharacterized protein {ECO:0000313|EMBL:OGJ13282.1} KW=Complete proteome OX=1801883 OS=Candidatus Pacearchaeota archaeon RBG_19FT_COMBO_34_9. GN=A3K82_01850 OC=Archaea; Candidatus Pacearchaeota.
Sequence
MKNKKYKFLEHTADVKFLASGKTPEKLFINSALALKESMCGKIKVGEKIKKSIKIKRKDF
EALLYGFLEEILFMLDAENFLISRISSIKISNKFDLKATIIGDRASEYEFTNPVKAVTYN
EMFVRKEKVPSDKDENKKVEVWIAQAVLDV
Download sequence
Identical sequences A0A1F6Z3V1 A0A1F6ZDP1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]