SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F7XQA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F7XQA1
Domain Number 1 Region: 1-124,159-210
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.67e-32
Family Nucleotide and nucleoside kinases 0.00054
Further Details:      
 
Domain Number 2 Region: 124-160
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.00000000000419
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1F7XQA1
Sequence length 216
Comment (tr|A0A1F7XQA1|A0A1F7XQA1_9BACT) Adenylate monophosphate kinase {ECO:0000256|HAMAP-Rule:MF_00235} KW=Complete proteome OX=1802486 OS=Candidatus Woesebacteria bacterium RBG_19FT_COMBO_37_29. GN=A2V55_01645 OC=Bacteria; Candidatus Woesebacteria.
Sequence
MNLILLGPPGSGKGTQGKILAKKYNLFYFEAGDFARELAQKDPRIKNIIEKGNLIPEKEM
TQYVDKLLEEKKPAGKNILFDGYPRFVSQYKDLANWLSKRQAKIDKAIFLDISDDIVVNR
LSSRRICAECGASYNLITNPPLQENKCDKCQGNLIQRSDDTPLSIKERLAEYRINVEPLI
EYLKSQGTLLRVSGESSIADITEDIIKEFDKEGLNA
Download sequence
Identical sequences A0A1F7X672 A0A1F7XQA1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]