SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F7YUS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F7YUS4
Domain Number 1 Region: 1-124,155-205
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.68e-31
Family Nucleotide and nucleoside kinases 0.0005
Further Details:      
 
Domain Number 2 Region: 123-151
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.00000598
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1F7YUS4
Sequence length 211
Comment (tr|A0A1F7YUS4|A0A1F7YUS4_9BACT) Adenylate monophosphate kinase {ECO:0000256|HAMAP-Rule:MF_00235} KW=Complete proteome; Reference proteome OX=1802500 OS=Candidatus Woesebacteria bacterium RIFCSPHIGHO2_01_FULL_41_10. GN=A2801_01305 OC=Bacteria; Candidatus Woesebacteria.
Sequence
MNIILLGPQGSGKGTQAEILSKEFNLYHFDMGKYLRDIAESDPSMNEVINKEGALLPDEQ
VFNIMKAHFEEKGQFDNILFEGYPRSKKQYQLLVDWLKEHGMTINVAFNLRISEELTIKR
VSGRRIDKTTGKLYHIETNPPGPEVDPANLVQRPDDRFDALKRRLEYYHKDTEPLINELI
SQGVMRDIDGSGNVEVVAKEIRQILHEISPK
Download sequence
Identical sequences A0A1F7YUS4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]