SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F8T804 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F8T804
Domain Number 1 Region: 5-69
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.0000000000157
Family Steroid-binding domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1F8T804
Sequence length 82
Comment (tr|A0A1F8T804|A0A1F8T804_9CHLR) Uncharacterized protein {ECO:0000313|EMBL:OGO68295.1} KW=Complete proteome; Reference proteome OX=1797671 OS=Chloroflexi bacterium RBG_19FT_COMBO_62_14. GN=A2Z37_11965 OC=Bacteria; Chloroflexi.
Sequence
MIGDRPVTRRELMKGTGERGGRCFVAHAGIVYDVTDCPKWRTGLHEQLHFAGQDLTSEIA
EAPHETDVFLRPCVHRIGPLID
Download sequence
Identical sequences A0A1F8T804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]