SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F8TJP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F8TJP4
Domain Number 1 Region: 25-224
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.6e-28
Family Matrix metalloproteases, catalytic domain 0.032
Further Details:      
 
Domain Number 2 Region: 236-329
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000275
Family Collagen-binding domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1F8TJP4
Sequence length 333
Comment (tr|A0A1F8TJP4|A0A1F8TJP4_9CHLR) Uncharacterized protein {ECO:0000313|EMBL:OGO72416.1} KW=Complete proteome; Reference proteome OX=1797670 OS=Chloroflexi bacterium RBG_19FT_COMBO_56_12. GN=A2Z49_02485 OC=Bacteria; Chloroflexi.
Sequence
MSNEELHICFDRVWEPASAEEMALLENTLWKPGATLRVRFLDGMPGVQAKVEQVARQWCE
YANIKFNFGSDPDAEIRISFKADPGSWSYLGNVALAIPKDRPTMNYGWLKPETSDEEYLR
VVLHEFGHALGCIHEHQHPTAGIPWNKPEVYRRYAGPPNFWSTEKVDFNLFKKYSADQTQ
FSAFDTASIMLYPIPKQLTDGVFEVGWNRQLSETDKSYIATIYSFELTPVVELMIGAAPA
SADIGQQGEEDLFRFRVLTQGAYVVETEGTTDVMIGLFGPDSRAQLVAGDDDSGRGLNAR
VIADLKPGDYFVRVHHYSKLGTGKYTISVRAAT
Download sequence
Identical sequences A0A1F8TJP4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]