SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F8UGU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F8UGU1
Domain Number 1 Region: 64-109
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.0000785
Family N-terminal coiled coil domain from apc 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1F8UGU1
Sequence length 257
Comment (tr|A0A1F8UGU1|A0A1F8UGU1_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:OGO83447.1} KW=Complete proteome; Reference proteome OX=1797676 OS=Chromatiales bacterium RIFOXYA1_FULL_46_5. GN=A2203_09210 OC=unclassified Chromatiales.
Sequence
MSNNNIRKSLVASALFGAFALASTSVAADPLSELQKAGQQNIRASVQSQEKINNIFDQSQ
ELLAEYRQLVEQTENLKVYNDHVAKLVADQNSQLASFDKQIGTIEGTKQGIVPLMYRMVD
TLEAFIKADMPIDITNRLARIERLRAVLGNSAVNTSEMYRLVIEAYQVEKDLGTALVTYT
DKLNVDGGEITVNYVYVGRVALLAQSLDEKQAWMFNRTTGQWEALGQEYLESTKFAIRVA
GKQAAPELLKLPVLAAE
Download sequence
Identical sequences A0A1F8UGU1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]