SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F9NBK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F9NBK6
Domain Number 1 Region: 13-241
Classification Level Classification E-value
Superfamily CbiG N-terminal domain-like 3.14e-56
Family CbiG N-terminal domain-like 0.00033
Further Details:      
 
Domain Number 2 Region: 227-353
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 1.44e-37
Family CobE/GbiG C-terminal domain-like 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1F9NBK6
Sequence length 355
Comment (tr|A0A1F9NBK6|A0A1F9NBK6_9DELT) Uncharacterized protein {ECO:0000313|EMBL:OGR14631.1} KW=Complete proteome OX=1797910 OS=Desulfobacula sp. GWF2_41_7. GN=A2097_08965 OC=Desulfobacteraceae; Desulfobacula.
Sequence
MVIELLKNKTIPDHLAIWCITPKGKTLGLKLKTALQNPALFISNRIGDGFDNRQGIFGFD
TLSHEIRKKFNQYSGHIFIFSTGIAVRLIAPLLKSKIMDPAIVVVDENGNHAISLISGHI
GGANALAKKIADMIQASPVITTATDTNDLPAIDLIAKEKRLFIETPRNIKRINMAFLIGK
SIDLYDPFGFVETELKDFLLSKTPDDREGFEKIFCSYEIGPVSRETMILRPPLLSVGIGC
NRGTGVKAIYDFLTHVFKENGLSIRSIDRLSTIDLKKNEEGLLALAKKMKLPMEFHTREK
LNSIKSIETPSEMVEKHVGVKSVSEASAVLSAGNGKLIVTKKKNKDVTIAVAIKK
Download sequence
Identical sequences A0A1F9NBK6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]