SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G0GZ34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G0GZ34
Domain Number 1 Region: 24-118
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000536
Family Pseudo ankyrin repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1G0GZ34
Sequence length 422
Comment (tr|A0A1G0GZ34|A0A1G0GZ34_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:OGT42894.1} KW=Complete proteome; Reference proteome OX=1798277 OS=Gammaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_37_34. GN=A3F42_08215 OC=Bacteria; Proteobacteria; Gammaproteobacteria.
Sequence
MPNMRTGTKHQSANSLYRKYGDHAIIEAIKNGQSFDVLKYLIQKKLCPFVFSQTAPHNEY
NDYEETTILSIAEKYAHLHFLRWLTAQYQIGKEELKEIFPAAVRHKHFKIVEWLINKKKI
CHWDAVIEAINHSNLPLNDKRKLYVAYFNQYPRELLHANHLEKVFQIFTSPFFIEMMSSE
KKKNAFKEKYFSFLHQALESTINEKNTYKIILQNYTRIDAEAAFQFHINLFLKNFKYKEI
NDYCLNIIHRKNKCETLARMTLAELLLINYFEWDETNSPLNNFTLKENHLKRAAQAFYLI
KNCESDIAHRLKQRLHQTLSGNTTPYNLGSVSIETWLPHVRYFYLLYVIYKDMTNDSTIQ
TMIKLEQTHYLAHTQTKLSETTPYSNNKRKQATLELYFFKANKKPKNEAINISSPSILSK
YV
Download sequence
Identical sequences A0A1G0GZ34

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]