SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G0WV67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G0WV67
Domain Number 1 Region: 41-253
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000000012
Family Pseudo ankyrin repeat 0.0000933
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1G0WV67
Sequence length 590
Comment (tr|A0A1G0WV67|A0A1G0WV67_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:OGV25332.1} KW=Complete proteome; Reference proteome OX=1798568 OS=Legionellales bacterium RIFCSPHIGHO2_12_FULL_37_14. GN=A3F18_00005 OC=Bacteria; Proteobacteria; Gammaproteobacteria; Legionellales.
Sequence
MSIAEIQRAALSGDIEEIKRLESGLNAEEQKAAVMACGYAAIQNAVQNGHIEIIKYLESH
LSAREKTAAVVADDYVAIRFAAHNGHTETIKYLASHLSANEQKAAVMEVNYAAIRNAAQN
GHTETFRHFLTIDTVLAYAEAHVVEYGSLVNPYIRERIADLRMRKLNAEANNPQAVFDVG
EEEALCIFYMIRNLIRRGADNPHMMQDDIVFLLEIPAVKALAGAEVNGGNSNELLRLALS
LNNRDAAEILLNIPVVRDLAEANDYYASERRGELDLRALARNRESAMTGLTQGEQRRLAA
VNERYKAILANTGINNLIDDLRLQLKARFLQNPATITMDDGSLKELPVLYTDFIKLKLSE
NEKARALEAYYSHKDHTALRYLSKPNRWMHEHASYVYVDNNEHSLKYSTFEEYQPLIALL
YCAARDENIEDSEDFTPETRFAHFIDELSHIGRAHNWDRSRERDNKSEEYDDLEGDRPSC
YSGVKRRLFQAVLGHPLLIILTKPLRYNNQPAKPKISAGVIFSLVASITMGLGLIALACV
LLPPVGLITLGAVLGYSLSAAGFASAAGCLGFFGYKTHKAVESQKIPKLS
Download sequence
Identical sequences A0A1G0WV67

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]