SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G1I7H8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G1I7H8
Domain Number 1 Region: 4-146
Classification Level Classification E-value
Superfamily MTH1598-like 1.7e-30
Family MTH1598-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1G1I7H8
Sequence length 146
Comment (tr|A0A1G1I7H8|A0A1G1I7H8_9BACT) Uncharacterized protein {ECO:0000313|EMBL:OGW64501.1} KW=Complete proteome; Reference proteome OX=1801717 OS=Nitrospirae bacterium RIFCSPLOWO2_02_FULL_62_14. GN=A3H49_09870 OC=Bacteria; Nitrospirae.
Sequence
MTSSFRFLEDIALADSAFEARGDSPSELFAASARAVIETMVAPQTVSSTCTKAITRHDRS
LEELLFDWLADIVYLKDAEGLVFQDVVCTVEKRQADGDWQLNGTLTGEPIDPARHELRAD
IKAITKHRYEVRQDNGGWIATVVMDI
Download sequence
Identical sequences A0A1G1I7H8 A0A1G1KH87

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]