SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G1TVV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1G1TVV3
Domain Number - Region: 38-57,109-125
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0288
Family Pseudo ankyrin repeat 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1G1TVV3
Sequence length 149
Comment (tr|A0A1G1TVV3|A0A1G1TVV3_BACT4) DUF3791 domain-containing protein {ECO:0000313|EMBL:PLS62399.1} KW=Complete proteome OX=818 OS=Bacteroides thetaiotaomicron. GN=BJP75_001645 OC=Bacteroides.
Sequence
METNQTYQNELGSAMLPFVMRELVDTVMKRKTLPLEDALYYIYSSNLYKALLDENTKLWY
SSTLSLYEALEKEKTEQKKVQKDNPKILLFQMFCAENYRETKNISAKETLLLFSNHGVFE
FLYENFEMLHTQDTEYILDTIITYINKKA
Download sequence
Identical sequences A0A015SYB9 A0A069S9Z8 A0A078PQZ4 A0A078QJ87 A0A078QUJ7 A0A0H5QF16 A0A0I9UMR7 A0A139T0S3 A0A174X5D7 A0A1E9C4I8 A0A1G1TVV3 A0A1H7RI39 B3C670 B5CX77 C6IUD9 C6ZBG5 D7J5X7 E4W0N1 E5X3X0 I8ZBP7 I9FGQ2 K5Y588 Q5CZD5
gi|60650174|ref|YP_209727.1| WP_004295329.1.1104 WP_004295329.1.15915 WP_004295329.1.19130 WP_004295329.1.20211 WP_004295329.1.22866 WP_004295329.1.24025 WP_004295329.1.28290 WP_004295329.1.29459 WP_004295329.1.31541 WP_004295329.1.34002 WP_004295329.1.36345 WP_004295329.1.37988 WP_004295329.1.49420 WP_004295329.1.49999 WP_004295329.1.57999 WP_004295329.1.58084 WP_004295329.1.6251 WP_004295329.1.67491 WP_004295329.1.72715 WP_004295329.1.7590 WP_004295329.1.78705 WP_004295329.1.80163 WP_004295329.1.8648 WP_004295329.1.88795 WP_004295329.1.90162 WP_004295329.1.90763 WP_004295329.1.92549 WP_004295329.1.93484 WP_004295329.1.95559 WP_004295329.1.95750 272559.pBF9343.34c gi|60650174|ref|YP_209727.1|NC_006873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]