SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G2LA90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G2LA90
Domain Number 1 Region: 16-134
Classification Level Classification E-value
Superfamily MTH1598-like 0.00000000000811
Family MTH1598-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1G2LA90
Sequence length 145
Comment (tr|A0A1G2LA90|A0A1G2LA90_9BACT) Uncharacterized protein {ECO:0000313|EMBL:OHA07699.1} KW=Complete proteome; Reference proteome OX=1802279 OS=Candidatus Sungbacteria bacterium RIFCSPLOWO2_01_FULL_54_21. GN=A3B34_00455 OC=Bacteria; Candidatus Sungbacteria.
Sequence
MKAKQYQEFEIVPQDEHTHLRVRGSTVQDLFRNTLAGMAAFLSPDAATSPTQGRKITQEI
MVRAVDISSLLVEFISRVLAEQEARGAVFTQSAFRTFGDNFLDADITGIRVEEPAAEIRA
VSYADVDIKKNPDTGMFETTLVFET
Download sequence
Identical sequences A0A1G2LA90

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]