SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G2VMW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G2VMW7
Domain Number 1 Region: 5-174
Classification Level Classification E-value
Superfamily LigT-like 1.07e-25
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1G2VMW7
Sequence length 176
Comment (tr|A0A1G2VMW7|A0A1G2VMW7_9BACT) Uncharacterized protein {ECO:0000313|EMBL:OHB22976.1} KW=Complete proteome; Reference proteome OX=1817744 OS=Parcubacteria group bacterium RIFCSPLOWO2_02_FULL_40_12. GN=A3I22_00890 OC=Bacteria; unclassified Parcubacteria group.
Sequence
MDDSVSLKEYSLWLMPEREEAEIIKSFFIKVRRLINTIAFKPHVTLLGGLTLSEPQIIER
IDKLAAETAPFRVFFTEAGETEGFYKSIFLKCEETEELMEMNKYAQELFSTNNPYIPHMS
VIYGDIDPTTKKEILDSIDLLTIQSLAFNVDSIFLCKAFGTCDEWEIIYEIPLKNR
Download sequence
Identical sequences A0A1G2VMW7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]