SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G2W3E7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G2W3E7
Domain Number 1 Region: 1-124
Classification Level Classification E-value
Superfamily RPA2825-like 1.7e-18
Family RPA2825-like 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1G2W3E7
Sequence length 126
Comment (tr|A0A1G2W3E7|A0A1G2W3E7_9CAUL) Uncharacterized protein {ECO:0000313|EMBL:OHB28406.1} KW=Complete proteome; Reference proteome OX=1801944 OS=Phenylobacterium sp. RIFCSPHIGHO2_01_FULL_69_31. GN=A2790_15400 OC=Caulobacteraceae; Phenylobacterium.
Sequence
MSLMHRIVERIFHGDNGLAPRDWAKAAEGGGHQPPPRERTAMAPPSDVALVLSARAEREG
QGDDWRRSLDGLLELLHLDSSPEERAELAADLNLEPDAARDDAVLYEALIQRLAENGAAA
PESFYK
Download sequence
Identical sequences A0A1G2W3E7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]