SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G4H9H2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1G4H9H2
Domain Number - Region: 90-131
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0204
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1G4H9H2
Sequence length 269
Comment (tr|A0A1G4H9H2|A0A1G4H9H2_PLAVI) Uncharacterized protein {ECO:0000313|EMBL:SCO71551.1} KW=Complete proteome OX=5855 OS=Plasmodium vivax (malaria parasite P. vivax). GN=PVC01_060008800 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MVKIGKKLKGFDEGINRHDTHIGGDASQEKDTQVGNGPEKGTGQKFITLLGDHVGEHTSI
EAINGRGPLEDAAANLCGSNADAEDQANPADINAYVERSGTSTLLTLLLYKVLTTKPKNV
VNYITDELAILLNHELEMKEAKKDGHVERDSPKGTPSKDETDSKSNALNESDFSARYTPT
QLINHKAFLGDSFITLDDLFDAVKLIKIENCDKVYFNSLLKILRPFENDQNRDILLKENV
QPNECIPLNWALYLTTTFYNNCIGGASGV
Download sequence
Identical sequences A0A0J9SXZ1 A0A0J9TGH1 A0A0J9V6N8 A0A0J9WEL2 A0A1G4H9H2 A5KCC3
XP_001612714.1.43797 gi|156093349|ref|XP_001612714.1| gb|PVX_001770 5855.PVX_001770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]