SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G4HIM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G4HIM3
Domain Number 1 Region: 139-169
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000017
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1G4HIM3
Sequence length 186
Comment (tr|A0A1G4HIM3|A0A1G4HIM3_PLAVI) Uncharacterized protein {ECO:0000313|EMBL:SCO74827.1} KW=Complete proteome OX=5855 OS=Plasmodium vivax (malaria parasite P. vivax). GN=PVC01_130031300 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MFPGGDSQLFNFGGPERNEGGDPGEELQNETHRRLINFPTSLNANFARPVLDFQKIEPSY
FLTNDLSRRPAGGEAAWEKEEEGGPREEITFEKEVDEEREHKKRITLFDLSEEQKEKVKH
FKIKKVLQNEVYLKKNKILKYLVHMFVCDLLREKPDDIYEFAACYFTHPQLRQSVARRLR
GMIGGP
Download sequence
Identical sequences A0A0J9SM22 A0A0J9T7H2 A0A0J9UYI4 A0A0J9WA01 A0A1G4HIM3 A5K0Z2
gb|PVX_085250 gi|156102046|ref|XP_001616716.1| 5855.PVX_085250 XP_001616716.1.43797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]