SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G4HYL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1G4HYL6
Domain Number - Region: 11-52
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00915
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1G4HYL6
Sequence length 84
Comment (tr|A0A1G4HYL6|A0A1G4HYL6_TRYEQ) Uncharacterized protein {ECO:0000313|EMBL:SCU64389.1} KW=Complete proteome OX=5694 OS=Trypanosoma equiperdum. GN=TEOVI_000788800 OC=Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae; Trypanosoma.
Sequence
MSYQSSEAKKEEFRKYLEGKQVIDTLTRVLVNLYEEPEKPDDPVDFIKKVLGGASTADYE
ALQQENACLKAEVAALKKRLNEEH
Download sequence
Identical sequences A0A1G4HYL6 C9ZYD0 Q38E79
gi|71745182|ref|XP_827221.1| XP_011776695.1.14543 XP_827221.1.54365 Tb09.211.0775 Tb427tmp.211.0775 Tbg972.9.5050 5691.Tb09.211.0775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]